|
| |
Sponsored Results
HBD Results From BioPortfolio's Antibody Search
beta 2 Defensin antibody (ab9871) | Abcam
Western Blot:To detect hBD-2 by Western Blot analysis this antibody can be ... hBD-2 is a antimicrobial peptide, which belongs to the distinct family of ...
http://www.abcam.com/beta-2-Defensin-antibody-ab9871.html...
|
 |
|
hBD-1, β-Defensin-1, human
Peptides , Defensins , hBD-1, β-Defensin-1, human; DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35); ...
http://www.anaspec.com/products/product.asp?id=32254...
|
 |
|
Beta Defensins
The alignment includes the sequences of four human defensins (hBD-1, hBD-2, ... For comparison, amino acid sequences of the human beta-defensins hBD-1 and ...
http://www.phoenixpeptide.com/catalog/pnxfoget.php?id=pnxnew...
|
 |
|
|
hBD-4, β-Defensin-4, human
Peptides , Defensins , hBD-4, β-Defensin-4, human; ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (Disulfide bridge: 6-33; 13-27; 17-34); ...
http://www.anaspec.com/products/product.asp?id=32256...
|
 |
|
Polyclonal Antibody to Defensin-3 (bD-3)
hBD-3 demonstrated a salt-insensitive broad spectrum of potent antimicrobial ... Keratinocytes and airway epithelial cells are cellular sources of hBD-3. ...
http://www.imgenex.com/antibody_details.php?catalog=IMG-4090...
|
 |
|
hBD-3, β-Defensin-3, human
Peptides , Defensins , hBD-3, β-Defensin-3, human; GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41); ...
http://www.anaspec.com/products/product.asp?id=32255...
|
 |
15210 Bis[tri-n-butyltin(IV)]oxide HBD, TBTO technical
Synonym: HBD, Hexabutyldistannoxane, TBTO, Tributyltin(IV) oxide. CAS Number: 56 -35-9. Linear Formula: (CH3CH2CH2CH2)3SnOSn(CH2CH2CH2CH3)3 ...
http://www.sigmaaldrich.com/catalog/ProductDetail.do?D7=0&N5...
|
 |
beta Defensin 3 antibody (ab1128) | Abcam
This antibody reacts with residues 23-33 [GIINTLQKYYC]of the 5 kDa hBD-3 protein .The numbering referred to the precursor of the protein (1-11 of the mature ...
http://www.abcam.com/beta-Defensin-3-antibody-ab1128.html...
|
 |
B53383 Bis(tributyltin) oxide HBD, TBTO 96%
Employed in the synthesis of ,-unsaturated methyl ketones, isoxazoles, fungicides, and bactericides.
http://www.sigmaaldrich.com/catalog/ProductDetail.do?D7=0&N5...
|
 |
|
DEFB103A protein, BD-3 Human recombinant protein
HBD3, HBP3, DEFB3, HBD-3, HBP-3, DEFB103.; Defensin, beta 103; Beta-defensin 3; BD-3; hBD-3; HBD3; DEFB-3; Defensin-like protein; Beta-defensin 103, ...
http://www.genwaybio.com/product_info.php?products_id=45790...
|
 |
|
Anti-Tumor Endothelial Marker 5 Polyclonal Antibody
Tumor Endothelial Marker 5, like GPR125, has a leucine rich repeat (LRR), an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). ...
http://www.bioreagents.com/products/productDetails/productDe...
|
 |
|
DEFB1 antibody, Rabbit anti beta-Defensin-1 (a.a. 1-5) Antibody ...
Rabbit anti beta-Defensin-1 (aa 1-5); BD-1; hBD-1; Defensin, beta 1; Beta- defensin 1, DEFB1_HUMAN. [ N/A NP_005209.1 P60022 ]. ( GenWay 18-511-244698 online ...
http://www.genwaybio.com/product_info.php?products_id=244698...
|
 |
Lactate Dehydrogenase antibody (ab55433) | Abcam
As it can also catalyze the oxidation of hydroxybutyrate, it is occasionally called Hydroxybutyrate Dehydrogenase (HBD). There are 5 different isoenzymes of ...
http://www.abcam.com/Lactate-Dehydrogenase-antibody-ab55433....
|
 |
|
Anti-G Protein-Coupled Rec. 125 Polyclonal Antibody
GPR125, has a leucine rich repeat (LRR), an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain shows similarities to motilin and ...
http://www.bioreagents.com/products/productDetails/productDe...
|
 |
GPCR GPR125 antibody (ab51705) | Abcam
GPR125 is an orphan receptor which has a leucine rich repeat (LRR),an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain sh ...
http://www.abcam.com/GPCR-GPR125-antibody-ab51705.html...
|
 |
Hemoglobin β/γ/δ (H-76) Antibody sc-21006
Human, HBD, 3045, 11p15.4, NM_000519 · P02042 · 142000. Human, HBG1, 3047, 11p15 .4, NM_000559 · P69891 · 142200. Mouse, Hbb-b1, 15129, 7 E3, P02088 ...
http://www.scbt.com/datasheet-21006-hemoglobin-beta-gamma-de...
|
 |
Lactate Dehydrogenase C antibody [EP1746Y] (ab52747) | Abcam
It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate. In mammals, three types of LDH subunits (35 ...
http://www.abcam.com/Lactate-Dehydrogenase-C-antibody-EP1746...
|
 |
|
CATALYST -generated Olfactophore Models for Structure-Odor ...
8.1 Å from the HBD. A single excluded volume accounts for steric ... donor (HBD) . The best hypothesis was mapped by (Z)-(-)-β-santalol (3) and Javanol (4). ...
http://accelrys.com/resource-center/case-studies/pdf/catalys...
|
 |
|
LL37 , KR-12 and WLBU2
25 Sep 2008 ... We compared the levels of expression of LL-37 and human beta-defensin 2 (HBD-2) in inflamed skin from patients with atopic dermatitis and ...
http://www.phoenixpeptide.com/catalog/pnxfoget.php?id=pnxnew...
|
 |
LL-37 (C-14) Antibody sc-21578
Bacterial exotoxins downregulate cathelicidin (hCAP-18/LL-37) and human beta- defensin 1 (HBD-1) expression in the intestinal epithelial cells. Cell. ...
http://www.scbt.com/datasheet-21578-ll-37-c-14-antibody.html...
|
 |
Links to Bioportfolio Gene Database:DEFB1 | DEFB4 | DEFB128 | DEFB127 | RHBDF2 | ATGHBDH/GHBDH | |