Monday November 23 2009 | Biotechnology feed | All feeds

HBD

Suggest Content
Advertise Here
Gene DB Home

Symbol:	HBD
Name(s):	hemoglobin, delta
Type:	protein-coding
Organism:	Homo sapiens
Synonyms:	-
Links:	Pubmed, Entrez Gene, GeneCards, BioGPS, Map Viewer.

Gene Information from Publications
Publication Link	Summary of findings
11939506	Hb A2-Monreale [delta146(HC3)His-->Arg]is a novel delta chain variant.
15757827	Deletion pf this geneis a common, and possibly the predominant beta-thalassemia mutation of the Austroasiatic Lao Theung population.
11860449	The 5' breakapoint of the (deltabeta)(0) thalassemia deletion in a compound heterozygote was located in the second intron of the delta globin gene.
15449937	The atomic coordinates of the delta-chain of hemoglobin A2 (R2 state) are used to model the structure of hemoglobin homotetramer delta 4, which occurs in rare hemoglobin H disease.
15234005	alternate mRNA species in adult erythroid cells; mRNA encodes an additional 145 nt in the upstream untranslated region, suggesting an alternative site of transcriptional initiation and transcription through the previously defined promoter

Recent Publications on HBD:
Pharmacophore Modeling for Qualitative Prediction of Antiestrogenic Activity. A ligand-based pharmacophore approach for the prediction of antiestrogenic...	3rd November, 2009	Dipartimento Farmaco Chimico Tecnologico, Universita degli Studi di Siena,	J Chem Inf Model. 2009 Oct 30. DOI Direct Link
HIV type 1 fails to trigger innate immune factor synthesis in differentiated oral epithelium. The oral mucosa is relatively resistant to human immunodeficiency virus...	22nd October, 2009	Epidemiology Unit, Faculty of Medicine, Prince of Songkla University, Hat	AIDS Res Hum Retroviruses. 2009 Oct;25(10):1013-21. DOI Direct Link
[Construction of HBD-3 gene mammary-specific expression vector and eukaryotic expression] To establish human beta-defensin-3 gene transgenic cell lines as competent...	20th October, 2009	Institute of Biotechnology, College of Animal Veterinary Medicine,	Sheng Wu Gong Cheng Xue Bao. 2009 Jul;25(7):968-74.
[Analysis of risk factors for nosocomial infections in the Neonatal Intensive Care Unit of the Pomeranian Medical University in Szczecin in the years 2005-2008] The aim of the study was to assess the significance of some perinatal risk...	15th October, 2009	Klinika Neonatologii PAM w Szczecinie.	Ginekol Pol. 2009 Aug;80(8):609-14.
Modulation of human beta-defensin-2 expression by 17beta-estradiol and progesterone in vaginal epithelial cells. We investigated the expression of HBD-1 and -2 in vaginal epithelial cells...	13th October, 2009	Department of Urology, KEPCO Medical Foundation Hanil General Hospital,	Cytokine. 2009 Oct 8. DOI Direct Link
→View more research publications.

Press Releases on HBD:
Abbott Submits Application for Approval of XIENCE(TM) V Everolimus Eluting Coronary Stent System in Japan	2nd June, 2008	Abbott	TOKYO, June 2 /PRNewswire-FirstCall/ -- Abbott (NYSE: ABT) today announced that it has submitted an application for Seizo

Clinical Trials:
Analysis of the Response of Subjects With Atopic Dermatitis to Oral Vitamin D3 by Measurement of Antimicrobial Peptide Expression in Skin and Saliva

Patents:
US Patent No.	Title
7284308	Method for manufacturing a leaf spring
7381813	Nucleic acids encoding estrogen receptor ligand binding domain variants
7384911	Peptides having antimicrobial properties and compositions containing them, notably for the preservation of foodstuffs
7417897	Method for reading a single-poly single-transistor non-volatile memory cell
7419781	Human antibiotic proteins
→View more patents.

HBD results (if any) from reagent suppliers

beta 2 Defensin antibody (ab9871) \| Abcam Western Blot:To detect hBD-2 by Western Blot analysis this antibody can be ... hBD-2 is a antimicrobial peptide, which belongs to the distinct family of ... http://www.abcam.com/beta-2-Defensin-antibody-ab9871.html...
hBD-3, β-Defensin-3, human Peptides , Defensins , hBD-3, β-Defensin-3, human; GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41); ... http://www.anaspec.com/products/product.asp?id=32255...
Beta Defensins The alignment includes the sequences of four human defensins (hBD-1, hBD-2, ... For comparison, amino acid sequences of the human beta-defensins hBD-1 and ... http://www.phoenixpeptide.com/catalog/pnxfoget.php?id=pnxnew...
hBD-4, β-Defensin-4, human Peptides , Defensins , hBD-4, β-Defensin-4, human; ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (Disulfide bridge: 6-33; 13-27; 17-34); ... http://www.anaspec.com/products/product.asp?id=32256...
beta 2 Defensin antibody (ab9871) reviews \| Abcam We have successfully used your goat anti-hBD-2 (ab9871) in a sandwich ELISA. ... Recombinant hBD-2 was added at 3 ug/ml and bound peptide detected using ... http://www.abcam.com/index.html?pageconfig=reviews&intAbID=9...
hBD-1, β-Defensin-1, human Peptides , Defensins , hBD-1, β-Defensin-1, human; DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35); ... http://www.anaspec.com/products/product.asp?id=32254...
Human BD-1 ELISA Development Kit and/or recombinant hBD-1 in a sandwich. ELISA format within the range of 4–. 1000pg/ml. ... to assay hBD-1 in approximately 1000. ELISA plate wells. ... http://www.leinco.com/ELISA/Beta-Defensin-1/pdf/B619.pdf?PHP...

Resources from the NCBI used on this page, NCBI's standard disclaimer applies.

Nothing in this website should be used in place of personal medical advice from your own qualified medical practitioner.

HBD

Gene Information from Publications

Recent Publications on HBD:

Press Releases on HBD:

Clinical Trials:

Patents:

HBD results (if any) from reagent suppliers