|
| |
ACPP
Gene Information from Publications |
| Publication Link |
Summary of findings |
| 15985366 |
the GAAAATATGATA-like elements are involved in the transcriptional regulation of hPAP promoter constructs in prostatic cells. |
| 11833784 |
Effect of tartaric acid on conformation and stability of human prostatic phosphatase: an infrared spectroscopic and calorimetric study. |
| 16076555 |
1,25D-mediated decreases in prostate cancer cells and C81 LN cell growth are in part due to decreases in tyrosine kinase signaling that result from up-regulation of cellular prostatic acid phosphatase. |
| 12032838 |
Identification and characterization of regulatory elements of the human prostatic acid phosphatase promoter. |
| 17455230 |
PAP (133-152) and PAP (173-192) were immunogenic and processed from whole PAP in HLA-DRB1*1501 tg mice. These peptides were capable of stimulating CD4 T lymphocytes from HLA-DRB1*1501-positive patients with granulomatous prostatitis and normal donors. |
| 17638863 |
Prostatic acid phosphatase is not a prostate specific target |
| 15240830 |
Transcriptional activation of the prostatic acid phosphatase gene by NF-kappaB in human prostate cancer cells. |
| 15280042 |
Prostatic acid phosphatase inactivates lysophosphatidic acid in seminal plasma. |
| 12719131 |
equilibrium unfolding of dimeric human prostatic acid phosphatase involves an inactive monomeric intermediate |
| 14623260 |
Human prostatic acid phosphatase's regulatory regions were analyzed in transgenic mice and cell line transfections, in order to clarify the mechanisms of tissue-specific gene expression | →View more information from publications. |
Recent Publications on ACPP: |  |
Transcriptional and functional characterization of the gene coding for acyl carrier protein from Bacillus subtilis.
Acyl carrier protein (ACP) is a universal and highly conserved carrier of... | 24th October, 2009
| Instituto de Biologia Molecular y Celular de Rosario (IBR-CONICET) and
| Microbiology. 2009 Oct 22.
DOI Direct Link |
SMc01553 is the sixth acyl carrier protein in Sinorhizobium meliloti 1021.
Acyl carrier proteins (ACPs) are required for the transfer of acyl... | 3rd October, 2009
| Centro de Ciencias Genomicas, Universidad Nacional Autonoma de Mexico.
| Microbiology. 2009 Oct 1.
DOI Direct Link |
New hypotheses on the function of the avian shell gland derived from microarray analysis comparing tissue from juvenile and sexually mature hens.
Activation of the shell gland region of the avian oviduct is mediated by... | 30th September, 2009
| Roslin Institute and Royal (Dick) School of Veterinary Studies, University
| Gen Comp Endocrinol. 2009 Sep 1;163(1-2):225-32. Epub 2009 Mar 20.
DOI Direct Link |
Oral cancer cells with different potential of lymphatic metastasis displayed distinct biologic behaviors and gene expression profiles.
Objective: Oral squamous cell carcinoma (OSCC) often spreads from the... | 15th August, 2009
| State Key Laboratory of Oral Diseases, West China Hospital of Stomatology,
| J Oral Pathol Med. 2009 Aug 12.
DOI Direct Link |
EphB2 and EphA4 receptors regulate formation of the principal inter-hemispheric tracts of the mammalian forebrain.
Previously, we have demonstrated that EphB2 activity is required for... | 15th August, 2009
| Department of Pharmaceutical Sciences, Leslie Dan Faculty of Pharmacy,
| Neuroscience. 2009 Jun 2;160(4):784-95. Epub 2009 Mar 13.
DOI Direct Link |
→View more research publications. |
ACPP results (if any) from reagent suppliers | 
|
Antibodies to Serum Proteins
human ... ACPP(55), human, ELISA (i), IHC (f), IHC (p), pricing. P5687, Monoclonal Anti-Prostatic Acid Phosphatase, Human antibody produced in mouse ...
http://www.sigmaaldrich.com/etc/controller/controller-page.h...
|
 |
Abgent - Cell and Function Antibodies
AP7592b, ACPP Antibody (C-term), WB, IHC, E, H. AT1029a, ACSL1 monoclonal antibody (M02), ELISA,S-ELISA,WB-Re, H. AP2535b, ACSL3 (FACL3) Antibody (Center)
...
http://www.abgent.com/products/category/cell_function...
|
 |
PAcP (045) Antibody sc-80908
Species, Gene Name, Gene ID, Chromosome Location, Isoform (mRNA) Accession #, Protein Accession #, OMIM™ Number. Human, ACPP, 55, 3q22.1, NM_001099 · P15309
...
http://www.scbt.com/datasheet-80908-pacp-045-antibody.html...
|
 |
P5664 Anti-Prostatic Acid Phosphatase antibody produced in rabbit ...
application(s), immunohistochemistry (formalin-fixed, paraffin-embedded sections ): 1:400 using human prostate tissue. Gene Information, human ... ACPP(55) ...
http://www.sigmaaldrich.com/catalog/ProductDetail.do?N4=P566...
|
 |
Abgent - Metabolism Antibodies - Metabolism
AP7561c, ACO2 Antibody (Center), WB, IHC, E, H. AP1936a, ACO2 Antibody (N-term), WB, E, H, R. AP7592b, ACPP Antibody (C-term), WB, IHC, E, H ...
http://www.abgent.com/products/category/cell_function/metabo...
|
 |
GenBank - New England Biolabs Homepage
... protein (ACP) from Escherichia coli (gene acpP)" /translation=" MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELV
MALEEEFDTEIPDEEAEKITTVQAAIDYINGHQAPAGIGAPGS" ...
http://www.neb.com/nebecomm/tech_reference/restriction_enzym...
|
 |
CopyCutter™ EPI400™ Electrocompetent E. coli - Cambio Ltd
... the full-length acpP clones in TransforMAX™ EC100™ cells were found to contain multiple point mutations. Figure 2. Uninduced CopyCutter™ EPI400™ E.
coli ...
http://www.cambio.co.uk/catalogue-CopyCutter_trade_EPI_trade...
|
 |
Search Bioportfolio and other Life Science Sites for ACPP,
or search for ACPP on BioPortfolio's antibody search engine.
This page has been viewed 418 times
Recent Search Terms used to find this page: acid phosphatase in 2009 | prostatic acid phosphatase antibody for western blot | regulatory regions of PAP in transgenic mice | prostatic acid phosphatese | acpp diagnostics | prostate phosphatase gene | ACP3 prostata 2009 | carcinoma prostata acp3 | acid phosphatase gene prostate | .
Resources from the NCBI used on this page, NCBI's standard disclaimer applies.
|
