Search Results for "Bnppatr Peptide"

04:09 EDT 21st September 2014 | BioPortfolio

Original Source: A slightly elevated level of N-terminal pro-brain natriuretic peptide can predict coronary artery disease in a population with normal left ventricular function.

The prognostic and diagnostic values of N-terminal pro-brain natriuretic peptide (NT-pro-BNP) in ischemic heart disease have already been investigated in many previous studies. Although NT-pro-BNP is affected by many factors, these previous studies did not strictly exclude them. This study included 110 patients who received coronary arteriography between November 2007 and September 2009. Excluded from the study were those patients who had clinical symptoms of heart failure, asynergy by echocardiography or l...

Matching Channels

Natriuretic peptide rDNA

TASH Biotechnology

Shanghai TASH Biotechnology Co.,Ltd. specializes in peptide development on the basis of high technology. TASH Biotechnology are focusing on custom peptide synthesis, and the research, development...

Drug Delivery - news, views, blogs

Drug delivery is the method or process of administering a pharmaceutical compound to achieve a therapeutic effect in humans or animals.  Drug delivery technologies are patent protected formulat...

Proteasome Inhibitors

The proteasome is involved in many essential cellular functions, such as regulation of cell cycle, cell differentiation, signal transduction pathways, antigen processing for appropriate immune respon...

Pseudomonas aeruginosa Vaccines

Pseudomonas aeruginosa is an opportunistic gram-negative bacteria that lives in soil, water, and even in environments like hot tubs. For most healthy people, this bacteria seldom poses a problem. Pse...

Matching News

Selectivity mechanism of a bacterial homolog of the human drug-peptide transporters PepT1 and PepT2

Guettou et al. describe structural studies on a bacterial homolog of PepT1 and PepT2 peptide transporters—nutrient transporters responsible for all peptide transport across the plasma membrane—in ...

Scientists Develop Rice-based Peptide Vaccine for Pollen Allergies

Scientists Fumio Takaiwa and Lijung Yang from the National Institute of Agrobiological Sciences (Japan) developed a universal peptide vaccine for Japanese cedar pollinosis, a major allergy related dis...

Zealand Pharma, Boehringer Ingelheim collaborate on novel peptide medicines

Zealand Pharma, specializing in the discovery, design and development of peptide medicines, and Boehringer Ingelheim have announced a new global R&D collaboration. The collaboration covers a novel the...

Imugene picks peptide manufacturer for HER-Vaxx

Imugene (ASX:IMU) has appointed a peptide manufacturer for its HER-2+ cancer vaccine HER-Vaxx in advance of a phase II gastric cancer trial. Swiss peptide chemistry company Bachem AG will conduct cli...

Pharmaceutical Research: Enhanced Transdermal Peptide Delivery and Stability by Lipid Conjugation: Epidermal Permeation, Stereoselectivity and Mechanistic Insights

Type: Original PaperPurposeEfficient delivery of therapeutic peptides to the skin will facilitate better outcomes in dermatology. The tetrapeptide AAPV, an elastase inhibitor with potential utility in...

Zealand, Boehringer to advance new peptide medicines

Denmark-based Zealand Pharma and Boehringer Ingelheim have entered into a new global exclusive licence, research and development collaboration, which covers a new therapeutic peptide project from Zeal...

Researchers reprogram nonribosomal peptide synthetases for clickable amino acids

A single targeted mutation is enough to alter a natural peptide system so that it also incorporates non-natural amino acids into peptides, report Swiss scientists in the journal Angewandte Chemie.

Control Strategies for Synthetic Therapeutic Peptide APIs Part III: Manufacturing Process Considerations

USP's Therapeutic Peptides Expert Panel discusses manufacturing processes and impurity control for synthetic peptide APIs.

Matching PubMed Articles

Eluding anaphylaxis allows peptide-specific prevention of the relapsing stage of experimental autoimmune encephalomyelitis.

We have used a peptide derived from Acanthamoeba castellanii (ACA) to treat the relapsing phase of EAE that develops in SJL mice following immunization with the PLP 139-151 peptide. The native sequenc...

Antibacterial activity and mechanisms of a new peptide derived from cell-penetrating peptide.

We studied the antibacterial activities and mechanism of a new peptide P7, according to the structure-activity relationships of cell-penetrating peptide and antimicrobial peptide.

Peptide Materials for Biomedicine and Nanotechnology.

Voltammetric detection of ovalbumin using a peptide labeled with an electroactive compound.

For this study, a new method was developed to electrochemically detect ovalbumin via its binding with the peptide-1(RNRCKGTDVQAW) in lysozymes. The peptide that exists at the C-terminal of a lysozyme ...

Effects of muscarinic acetylcholine 3 receptor(208-227) Peptide immunization on autoimmune response in nonobese diabetic mice.

The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205-237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certai...

Search Whole site using Google

Loading
Search BioPortfolio:
Loading
Advertisement
Advertisement
Advertisement Advertisement